| Catalog#: |
MK0463R |
| Product Name: |
Recombinant Rhesus macaque IL1B protein |
| Product Overview: |
Recombinant Rhesus macaque IL1B protein was expressed in Escherichia coli. |
| Description: |
Purified Recombinant Rhesus macaque Interleukin 1, Beta from Creative Biomart. IL1B (Rhesus macaque)(IL1B,Interleukin 1, Beta) can be used for research. |
| Source: |
E. coli |
| Species: |
Rhesus macaque |
| Tag: |
N/A |
| Formulation: |
Lyophilized from a 0.2μm filtered solution of PBS, pH 7.4. |
| Protein length: |
153 |
| AA Sequence: |
APVRSLHCTLRDAQLKSLVMSGPYELKALHLQGQDLEQQVVFSMSFVQGEESNDKIPVALGLKAKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTRGGQDITDFTMQFVSS |
| Purity: |
>98% as determined by SDS-PAGE. |
| Storage: |
Store under sterile conditions at -20°C to -80°C. Avoid repeated freeze-thaw cycles. |
| Reconstitution: |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
| Molecular Mass: |
Approximately 17.3 kDa, a single non-glycosylated polypeptide chain containing 153 amino acids. |
| Stability: |
Samples are stable for up to twelve months from date of receipt at -20°C to -80°C, three months at -20°C to -80°C after reconstitution. |
| Endotoxin: |
Less than 1.0 EU per μg as determined by the LAL method. |
| Notes: |
Research Use Only. Not for use in clinical procedures.Aoid repeated freeze-thaw cycles. |
