| Catalog#: |
MK0265H |
| Product Name: |
Recombinant Human EGFR protein, His-tagged |
| Product Overview: |
Recombinant Human EGFR(Leu25-Ser378) fused with His tag at C-terminal was expressed in HEK293 cells. |
| Source: |
HEK293 cells |
| Species: |
Human |
| Tag: |
His |
| Formulation: |
Lyophilized from a 0.2μm filtered solution of PBS, pH 7.4. |
| Protein length: |
Leu25-Ser378 |
| AA Sequence: |
LEEKKGNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLSINATNI KHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFE NLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQ KTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVE NSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHV CHLCHPNCTYGCTGPGLEGCPTNGPKIPSVDHHHHHH |
| Purity: |
>95% as determined by SDS-PAGE. |
| Storage: |
Store under sterile conditions at -20°C to -80°C. Avoid repeated freeze-thaw cycles. |
| Reconstitution: |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 0.1mg/mL.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Endotoxin: |
Less than 1.0 EU per μg as determined by the LAL method. |
| Notes: |
Research Use Only. Not for use in clinical procedures.Aoid repeated freeze-thaw cycles. |
